F[ÿWETSSKATEAREAHAREUNBARLEAPEVENPEACELARSNEEDSEFTLADLECOLTAAHCALVINUSCAPTILIAEARTHYLAWVASTVIACITEIMPFLIGHTOBIECOSAIDACTIONIREKNOBBLADEFROSOCKSLULLPLAIDULNAERIEREUSEZOOSDEADEATENOPTS ACROSS 1 Dampens 5 Glide along smoothly 10 Extent of space 14 Rabbit 15 Unbolt 16 Jump 17 Not odd 18 Freedom from war 19 Roman household gods 20 Necessities 22 Newt 23 Scoop 24 Young male horse 26 Exclamation of satisfaction 27 Protestant leader 31 So Cal Uni 32 Disposed 35 Hip bones 36 Grounded? 39 Legal science 40 Immense 41 By way of 42 Call to mind 43 Mischievous child 44 Winged travel 47 Off-Broadway theater award 48 Long-leaved lettuce 49 Help 50 Energetic activity 52 Wrath 53 Rounded lump 55 Part of an ice skate 58 To and ____ 59 Foot covers 64 Soothe 65 Tartan 67 Bone of the forearm 68 Great lake 69 Utilize again 70 Animal houses 71 No longer living 72 Consumed 73 Chooses DOWN 1 At what time 2 Overhanging lower edge of a roof 3 Woody plant 4 Transmit 5 Have dine 6 Rest on the knees 7 Toward the ship's rear 8 Diplomacy 9 Before 10 Supreme Being 11 Peruse 12 British nobleman 13 Church recess 21 ___ Fi Channel 23 Fine and delicate 25 First counting number 26 Powdery residue 27 Municipal 28 Memorable fort 29 Speaks with impediment 30 Large container 31 Beehive State 32 Person used as one's excuse 33 Courtyard 34 Between 37 Ardent 38 Big ____ Truck 42 Portable bed 44 Payment for travel 45 Falsehood 46 Chinese philosophy 51 Broadcast network 52 Stalled 53 Cabbage salad 54 Sound 55 Lost blood 56 Decoy 57 Others to Clarence Darrow 58 Bloodsucking insect 60 Liqueur of Greece 61 Horse's hoof sound 62 Rope complication 63 Disrespectful back talk 65 before (prefix) 66 Lair